Lineage for d2bozm1 (2boz M:1-303)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027382Protein M (medium) subunit [81481] (4 species)
  7. 3027383Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
    Uniprot P02953
  8. 3027390Domain d2bozm1: 2boz M:1-303 [145004]
    Other proteins in same PDB: d2bozh1, d2bozh2, d2bozl_
    complexed with bcl, bph, d10, fe, lda, po4, spn, u10; mutant

Details for d2bozm1

PDB Entry: 2boz (more details), 2.4 Å

PDB Description: Photosynthetic Reaction Center Mutant With Gly M203 Replaced With Leu
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2bozm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bozm1 f.26.1.1 (M:1-303) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhllsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

SCOPe Domain Coordinates for d2bozm1:

Click to download the PDB-style file with coordinates for d2bozm1.
(The format of our PDB-style files is described here.)

Timeline for d2bozm1: