SCOPe 2.08: Domain d2bozm1: 2boz M:1-303

Lineage for d2bozm1 (2boz M:1-303)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d2bozm1: 2boz M:1-303 [145004]
   Other proteins in same PDB: d2bozh1, d2bozh2, d2bozl_
   complexed with bcl, bph, d10, fe, lda, po4, spn, u10; mutant

Details for d2bozm1

PDB Entry: 2boz, 2.4 Å

PDB Description: Photosynthetic Reaction Center Mutant With Gly M203 Replaced With Leu

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2bozm1:

Sequence; same for both SEQRES and ATOM records:

>d2bozm1 f.26.1.1 (M:1-303) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhllsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgm

Timeline for d2bozm1:

• d2bozm1 first appeared in SCOP 1.75
  
• d2bozm1 appears in SCOPe 2.07