![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
![]() | Domain d2bnre2: 2bnr E:114-242 [145003] Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb2, d2bnrb3, d2bnrd1, d2bnre1 automatically matched to 2BNQ E:114-242 |
PDB Entry: 2bnr (more details), 1.9 Å
SCOPe Domain Sequences for d2bnre2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnre2 b.1.1.2 (E:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d2bnre2: