SCOP 1.75: Domain d2bnrd2: 2bnr D:115-204

Lineage for d2bnrd2 (2bnr D:115-204)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)

8. Domain d2bnrd2: 2bnr D:115-204 [145001]
   Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb1, d2bnrd1, d2bnre1
   automatically matched to 2BNQ D:115-204

Details for d2bnrd2

PDB Entry: 2bnr, 1.9 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOP Domain Sequences for d2bnrd2:

Sequence; same for both SEQRES and ATOM records:

>d2bnrd2 b.1.1.2 (D:115-204) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
yiqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

Timeline for d2bnrd2:

• d2bnrd2 is new in SCOP 1.75
  
• d2bnrd2 appears in SCOPe 2.01
  
• d2bnrd2 appears in the current release, SCOPe 2.08