SCOP 1.75: Domain d2bnrd1: 2bnr D:2-114

Lineage for d2bnrd1 (2bnr D:2-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)

8. Domain d2bnrd1: 2bnr D:2-114 [145000]
   Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb1, d2bnrd2, d2bnre2
   automatically matched to 2BNQ D:2-114

Details for d2bnrd1

PDB Entry: 2bnr, 1.9 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOP Domain Sequences for d2bnrd1:

Sequence; same for both SEQRES and ATOM records:

>d2bnrd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhp

Timeline for d2bnrd1:

• d2bnrd1 is new in SCOP 1.75
  
• d2bnrd1 appears in SCOPe 2.01
  
• d2bnrd1 appears in the current release, SCOPe 2.08