| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries) |
| Domain d2bnrd1: 2bnr D:2-114 [145000] Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb2, d2bnrb3, d2bnrd2, d2bnre2 automatically matched to 2BNQ D:2-114 |
PDB Entry: 2bnr (more details), 1.9 Å
SCOPe Domain Sequences for d2bnrd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnrd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhp
Timeline for d2bnrd1: