Lineage for d2bnqe2 (2bnq E:114-242)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294107Protein T-cell antigen receptor [49125] (7 species)
  7. 1294138Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (31 PDB entries)
  8. 1294142Domain d2bnqe2: 2bnq E:114-242 [144999]
    Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb_, d2bnqd1, d2bnqe1

Details for d2bnqe2

PDB Entry: 2bnq (more details), 1.7 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (E:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d2bnqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnqe2 b.1.1.2 (E:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2bnqe2:

Click to download the PDB-style file with coordinates for d2bnqe2.
(The format of our PDB-style files is described here.)

Timeline for d2bnqe2: