SCOPe 2.08: Domain d2bmkh1: 2bmk H:1-113

Lineage for d2bmkh1 (2bmk H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
   Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4

8. Domain d2bmkh1: 2bmk H:1-113 [144994]
   Other proteins in same PDB: d2bmka1, d2bmka2, d2bmkb2, d2bmkh2, d2bmkl1, d2bmkl2
   automated match to d1wc7b1
   complexed with iod, pdd

Details for d2bmkh1

PDB Entry: 2bmk, 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine

PDB Compounds: (H:) fab fragment of catalytic antibody 15a9, heavy chain

SCOPe Domain Sequences for d2bmkh1:

Sequence; same for both SEQRES and ATOM records:

>d2bmkh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
vtvss

Timeline for d2bmkh1:

• d2bmkh1 first appeared in SCOP 1.75
  
• d2bmkh1 appears in SCOPe 2.07