Lineage for d2bh1y_ (2bh1 Y:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904881Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) (S)
    contains extra C-terminal helix that packs against shorter N-terminal helix
  5. 1904882Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
    Pfam PF05157 (also includes PfamB PB000210)
  6. 1904890Protein automated matches [190505] (1 species)
    not a true protein
  7. 1904891Species Vibrio cholerae [TaxId:666] [187458] (1 PDB entry)
  8. 1904892Domain d2bh1y_: 2bh1 Y: [144991]
    Other proteins in same PDB: d2bh1a1, d2bh1a2, d2bh1b1, d2bh1b2, d2bh1x1
    automated match to d2bh1x1
    complexed with ca

Details for d2bh1y_

PDB Entry: 2bh1 (more details), 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
PDB Compounds: (Y:) general secretion pathway protein e,

SCOPe Domain Sequences for d2bh1y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh1y_ d.52.10.1 (Y:) automated matches {Vibrio cholerae [TaxId: 666]}
irrlpfsfanrfklvldwnedfsqasiyylaplsmealvetkrvvkhafqlielsqaefe
skltqvyq

SCOPe Domain Coordinates for d2bh1y_:

Click to download the PDB-style file with coordinates for d2bh1y_.
(The format of our PDB-style files is described here.)

Timeline for d2bh1y_: