SCOPe 2.05: Domain d2bh1y_: 2bh1 Y:

Lineage for d2bh1y_ (2bh1 Y:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family)
   contains extra C-terminal helix that packs against shorter N-terminal helix

5. Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
   Pfam PF05157 (also includes PfamB PB000210)

6. Protein automated matches [190505] (1 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [187458] (1 PDB entry)

8. Domain d2bh1y_: 2bh1 Y: [144991]
   Other proteins in same PDB: d2bh1a1, d2bh1a2, d2bh1b1, d2bh1b2, d2bh1x1
   automated match to d2bh1x1
   complexed with ca

Details for d2bh1y_

PDB Entry: 2bh1, 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae

PDB Compounds: (Y:) general secretion pathway protein e,

SCOPe Domain Sequences for d2bh1y_:

Sequence; same for both SEQRES and ATOM records:

>d2bh1y_ d.52.10.1 (Y:) automated matches {Vibrio cholerae [TaxId: 666]}
irrlpfsfanrfklvldwnedfsqasiyylaplsmealvetkrvvkhafqlielsqaefe
skltqvyq

Timeline for d2bh1y_:

• d2bh1y_ first appeared in SCOP 1.75, called d2bh1y1
  
• d2bh1y_ appears in SCOPe 2.04
  
• d2bh1y_ appears in SCOPe 2.06
  
• d2bh1y_ appears in the current release, SCOPe 2.08