Lineage for d2b9pv1 (2b9p V:5-98)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814802Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 1814803Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 1814804Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 1814805Protein Ribosomal protein L21p [141093] (3 species)
  7. 1814841Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
    Uniprot P60492 1-101
  8. 1814856Domain d2b9pv1: 2b9p V:5-98 [144983]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9pv1

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (V:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2b9pv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9pv1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOPe Domain Coordinates for d2b9pv1:

Click to download the PDB-style file with coordinates for d2b9pv1.
(The format of our PDB-style files is described here.)

Timeline for d2b9pv1: