Lineage for d2b9p81 (2b9p 8:2-64)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053117Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 1053118Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 1053119Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 1053120Protein Ribosomal protein L35p [143036] (3 species)
  7. 1053121Species Deinococcus radiodurans [TaxId:1299] [160056] (10 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 1053130Domain d2b9p81: 2b9p 8:2-64 [144980]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    automatically matched to 2ZJR 3:2-64
    protein/RNA complex

Details for d2b9p81

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (8:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2b9p81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9p81 d.301.1.1 (8:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d2b9p81:

Click to download the PDB-style file with coordinates for d2b9p81.
(The format of our PDB-style files is described here.)

Timeline for d2b9p81: