Lineage for d2b9p71 (2b9p 7:1-46)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273231Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2273232Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2273233Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2273234Protein Ribosomal protein L34p [144323] (3 species)
  7. 2273251Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 2273266Domain d2b9p71: 2b9p 7:1-46 [144979]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    protein/RNA complex
    protein/RNA complex

Details for d2b9p71

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2b9p71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9p71 j.118.1.1 (7:1-46) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d2b9p71:

Click to download the PDB-style file with coordinates for d2b9p71.
(The format of our PDB-style files is described here.)

Timeline for d2b9p71: