Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
Protein Ribosomal protein L27 [110326] (3 species) |
Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries) Uniprot P84123 |
Domain d2b9n01: 2b9n 0:2-85 [144968] Other proteins in same PDB: d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9n01:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9n01 b.84.4.1 (0:2-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]} ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa lsdgkvvfinkgkgarfisieaaq
Timeline for d2b9n01: