Lineage for d2b7hd_ (2b7h D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688647Species Dusicyon thous [TaxId:9620] [187446] (1 PDB entry)
  8. 2688648Domain d2b7hd_: 2b7h D: [144966]
    Other proteins in same PDB: d2b7ha_, d2b7hb1, d2b7hc_
    automated match to d1fhjb_
    complexed with hem, so4

Details for d2b7hd_

PDB Entry: 2b7h (more details), 2.2 Å

PDB Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution
PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d2b7hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7hd_ a.1.1.2 (D:) automated matches {Dusicyon thous [TaxId: 9620]}
vhltaeekslvsglwakvnvdevggealgrllivypwtqrffdsfgdlstpdsvmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahky

SCOPe Domain Coordinates for d2b7hd_:

Click to download the PDB-style file with coordinates for d2b7hd_.
(The format of our PDB-style files is described here.)

Timeline for d2b7hd_: