Lineage for d2b7hb1 (2b7h B:2-145)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686311Species Dusicyon thous [TaxId:9620] [186966] (1 PDB entry)
  8. 2686313Domain d2b7hb1: 2b7h B:2-145 [144965]
    Other proteins in same PDB: d2b7hd_
    complexed with hem, so4

Details for d2b7hb1

PDB Entry: 2b7h (more details), 2.2 Å

PDB Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d2b7hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7hb1 a.1.1.2 (B:2-145) Hemoglobin, alpha-chain {Dusicyon thous [TaxId: 9620]}
hltaeekslvsglwakvnvdevggealgrllivypwtqrffdsfgdlstpdsvmsnakvk
ahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgke
ftpqvqaayqkvvagvanalahky

SCOPe Domain Coordinates for d2b7hb1:

Click to download the PDB-style file with coordinates for d2b7hb1.
(The format of our PDB-style files is described here.)

Timeline for d2b7hb1: