SCOPe 2.08: Domain d2b7cb_: 2b7c B:

Lineage for d2b7cb_ (2b7c B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)
   automatically mapped to Pfam PF00736

5. Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries)

8. Domain d2b7cb_: 2b7c B: [144964]
   Other proteins in same PDB: d2b7ca1, d2b7ca2, d2b7ca3
   automated match to d2b7bb1
   mutant

Details for d2b7cb_

PDB Entry: 2b7c, 1.8 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a

PDB Compounds: (B:) elongation factor-1 beta

SCOPe Domain Sequences for d2b7cb_:

Sequence; same for both SEQRES and ATOM records:

>d2b7cb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqal

Timeline for d2b7cb_:

• d2b7cb_ first appeared in SCOP 1.75, called d2b7cb1
  
• d2b7cb_ appears in SCOPe 2.07