Lineage for d2b7bb1 (2b7b B:1117-1206)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028896Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
  5. 1028897Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)
  6. 1028901Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 1028902Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (6 PDB entries)
  8. 1028907Domain d2b7bb1: 2b7b B:1117-1206 [144963]
    Other proteins in same PDB: d2b7ba1, d2b7ba2, d2b7ba3
    complexed with gdp; mutant

Details for d2b7bb1

PDB Entry: 2b7b (more details), 2.6 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp
PDB Compounds: (B:) elongation factor-1 beta

SCOPe Domain Sequences for d2b7bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7bb1 d.58.12.1 (B:1117-1206) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqal

SCOPe Domain Coordinates for d2b7bb1:

Click to download the PDB-style file with coordinates for d2b7bb1.
(The format of our PDB-style files is described here.)

Timeline for d2b7bb1: