![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.12: eEF-1beta-like [54984] (1 family) ![]() |
![]() | Family d.58.12.1: eEF-1beta-like [54985] (2 proteins) |
![]() | Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (6 PDB entries) |
![]() | Domain d2b7bb1: 2b7b B:1117-1206 [144963] Other proteins in same PDB: d2b7ba1, d2b7ba2, d2b7ba3 complexed with gdp; mutant |
PDB Entry: 2b7b (more details), 2.6 Å
SCOPe Domain Sequences for d2b7bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7bb1 d.58.12.1 (B:1117-1206) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved dkvslddlqqsieededhvqstdiaamqal
Timeline for d2b7bb1: