SCOPe 2.08: Domain d2b7bb1: 2b7b B:1117-1206

Lineage for d2b7bb1 (2b7b B:1117-1206)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)
   automatically mapped to Pfam PF00736

5. Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries)

8. Domain d2b7bb1: 2b7b B:1117-1206 [144963]
   Other proteins in same PDB: d2b7ba1, d2b7ba2, d2b7ba3
   complexed with gdp; mutant

Details for d2b7bb1

PDB Entry: 2b7b, 2.6 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a and gdp

PDB Compounds: (B:) elongation factor-1 beta

SCOPe Domain Sequences for d2b7bb1:

Sequence; same for both SEQRES and ATOM records:

>d2b7bb1 d.58.12.1 (B:1117-1206) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqal

Timeline for d2b7bb1:

• d2b7bb1 first appeared in SCOP 1.75
  
• d2b7bb1 appears in SCOPe 2.07