Lineage for d2b66z1 (2b66 Z:1-175)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798714Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 1798715Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 1798716Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 1798751Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 1798759Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries)
  8. 1798774Domain d2b66z1: 2b66 Z:1-175 [144962]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1

Details for d2b66z1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (Z:) 50S ribosomal protein CTC

SCOPe Domain Sequences for d2b66z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66z1 b.53.1.1 (Z:1-175) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOPe Domain Coordinates for d2b66z1:

Click to download the PDB-style file with coordinates for d2b66z1.
(The format of our PDB-style files is described here.)

Timeline for d2b66z1: