Lineage for d2b66u1 (2b66 U:2-118)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347885Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2347926Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2347927Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2347928Protein Ribosomal protein L20 [74733] (4 species)
  7. 2347968Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2347981Domain d2b66u1: 2b66 U:2-118 [144960]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66u1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2b66u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d2b66u1:

Click to download the PDB-style file with coordinates for d2b66u1.
(The format of our PDB-style files is described here.)

Timeline for d2b66u1: