![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries) Uniprot P80340 1-49 |
![]() | Domain d2b6671: 2b66 7:1-46 [144957] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to 2ZJR 2:1-46 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b6671:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6671 j.118.1.1 (7:1-46) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
Timeline for d2b6671: