SCOPe 2.01: Domain d2b6671: 2b66 7:1-46

Lineage for d2b6671 (2b66 7:1-46)

1. Root: SCOPe 2.01

2. Class j: Peptides [58231] (120 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161305] (10 PDB entries)
   Uniprot Q9RSH2 1-46

8. Domain d2b6671: 2b66 7:1-46 [144957]
   Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1
   automatically matched to 2ZJR 2:1-46

Details for d2b6671

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2b6671:

Sequence; same for both SEQRES and ATOM records:

>d2b6671 j.118.1.1 (7:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

Timeline for d2b6671:

• d2b6671 first appeared in SCOP 1.75
  
• d2b6671 appears in SCOPe 2.02
  
• d2b6671 appears in the current release, SCOPe 2.08