![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
![]() | Protein Ribosomal protein L32p [144201] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries) Uniprot P80339 1-59 |
![]() | Domain d2b6651: 2b66 5:2-59 [144956] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to 2ZJR Z:2-59 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b6651:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6651 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d2b6651: