SCOP 1.75: Domain d2b6651: 2b66 5:2-59

Lineage for d2b6651 (2b66 5:2-59)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161178] (10 PDB entries)
   Uniprot P49228 2-59

8. Domain d2b6651: 2b66 5:2-59 [144956]
   Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1
   automatically matched to 2ZJR Z:2-59

Details for d2b6651

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (5:) 50S ribosomal protein L32

SCOP Domain Sequences for d2b6651:

Sequence; same for both SEQRES and ATOM records:

>d2b6651 g.41.8.5 (5:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d2b6651:

• d2b6651 is new in SCOP 1.75
  
• d2b6651 appears in SCOPe 2.01
  
• d2b6651 appears in the current release, SCOPe 2.08