Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
Protein Ribosomal protein L27 [110326] (3 species) |
Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries) Uniprot P84123 |
Domain d2b6601: 2b66 0:2-85 [144955] Other proteins in same PDB: d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b6601:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6601 b.84.4.1 (0:2-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]} ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa lsdgkvvfinkgkgarfisieaaq
Timeline for d2b6601: