Lineage for d2b42a1 (2b42 A:1-381)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060940Protein Xylanase inhibitor TAXI-I [110247] (1 species)
    pepsin-like protein that probably lost the protease activity
  7. 2060941Species Wheat (Triticum aestivum) [TaxId:4565] [110248] (4 PDB entries)
    Uniprot Q8H0K8 22-402
  8. 2060945Domain d2b42a1: 2b42 A:1-381 [144949]
    Other proteins in same PDB: d2b42b_

Details for d2b42a1

PDB Entry: 2b42 (more details), 2.5 Å

PDB Description: Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase
PDB Compounds: (A:) xylanase inhibitor-I

SCOPe Domain Sequences for d2b42a1:

Sequence, based on SEQRES records: (download)

>d2b42a1 b.50.1.2 (A:1-381) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]}
lpvlapvtkdpatslytipfhdgaslvldvagplvwstckggqppaeipcssptcllana
ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
vllrpdvyrplmdaftkalaaqhangapvaravvavapfgvcydtktlgnnlggyavpnv
qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
dmekkrlgfsrlphftgcggl

Sequence, based on observed residues (ATOM records): (download)

>d2b42a1 b.50.1.2 (A:1-381) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]}
lpvlapvtkdpatslytipfhdgaslvldvagplvwstckgeipcssptcllanaypapg
cpakpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacapskllaslp
rgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwpqftqsmpy
tplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpdvyrplmda
ftkalaaqgapvaravvavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmtgkns
mvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldfdmekkrlgfsrlphftg
cggl

SCOPe Domain Coordinates for d2b42a1:

Click to download the PDB-style file with coordinates for d2b42a1.
(The format of our PDB-style files is described here.)

Timeline for d2b42a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b42b_