Lineage for d2b3tb1 (2b3t B:7-354)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574480Fold e.38: Release factor [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 2574481Superfamily e.38.1: Release factor [75620] (2 families) (S)
  5. 2574482Family e.38.1.1: Release factor [75621] (2 proteins)
    Pfam PF00472
  6. 2574483Protein Peptide chain release factor 1, RF1 [111318] (2 species)
  7. 2574484Species Escherichia coli [TaxId:562] [160962] (1 PDB entry)
    Uniprot P0A7I0 7-354
  8. 2574485Domain d2b3tb1: 2b3t B:7-354 [144948]
    Other proteins in same PDB: d2b3ta_
    complexed with sah

Details for d2b3tb1

PDB Entry: 2b3t (more details), 3.1 Å

PDB Description: structure of complex between e. coli translation termination factor rf1 and the prmc methyltransferase
PDB Compounds: (B:) Peptide chain release factor 1

SCOPe Domain Sequences for d2b3tb1:

Sequence, based on SEQRES records: (download)

>d2b3tb1 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 {Escherichia coli [TaxId: 562]}
alherheevqallgdaqtiadqerfralsreyaqlsdvsrcftdwqqvqedietaqmmld
dpemremaqdelreakekseqleqqlqvlllpkdpddernaflevragtggdeaalfagd
lfrmysryaearrwrveimsasegehggykeiiakisgdgvygrlkfesgghrvqrvpat
esqgrihtsactvavmpelpdaelpdvnpadlridtfrssgaggqhvnttdsairithlp
tgivvecqdersqhknkakalsvlgarihaaemakrqqaeastrrnllgsgdrsdrnrty
nfpqgrvtdhrinltlyrldevmegkldmliepiiqehqadqla

Sequence, based on observed residues (ATOM records): (download)

>d2b3tb1 e.38.1.1 (B:7-354) Peptide chain release factor 1, RF1 {Escherichia coli [TaxId: 562]}
alherheevqallgdaqtiadqerfralsreyaqlsdvsrcftdwqqvqqlqvlllpkdp
ddernaflevragtggdeaalfagdlfrmysryaearrwrveimsasegehggykeiiak
isgdgvygrlkfesgghrvqrvpatesqgrihtsactvavmpelpdaelpdvnpadlrid
tfrssgaggqhvnttdsairithlptgivvecqdersqhknkakalsvlgarihaaemak
rqrrnsdrnrtynfpqgrvtdhrinltlyrldevmegkldmliepiiqehqadqla

SCOPe Domain Coordinates for d2b3tb1:

Click to download the PDB-style file with coordinates for d2b3tb1.
(The format of our PDB-style files is described here.)

Timeline for d2b3tb1: