SCOPe 2.06: Domain d2b12b1: 2b12 B:-4-103

Lineage for d2b12b1 (2b12 B:-4-103)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries)
   Uniprot P00044

8. Domain d2b12b1: 2b12 B:-4-103 [144947]
   Other proteins in same PDB: d2b12a_
   complexed with hem, znh

Details for d2b12b1

PDB Entry: 2b12, 3.02 Å

PDB Description: crystal structure of the protein-protein complex between f82y cytochrome c and cytochrome c peroxidase

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2b12b1:

Sequence; same for both SEQRES and ATOM records:

>d2b12b1 a.3.1.1 (B:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmaygglkkekdrndlitylkkace

Timeline for d2b12b1:

• d2b12b1 first appeared in SCOP 1.75
  
• d2b12b1 appears in SCOPe 2.05
  
• d2b12b1 appears in SCOPe 2.07
  
• d2b12b1 appears in the current release, SCOPe 2.08