SCOP 1.75: Domain d2b10d1: 2b10 D:-4-103

Lineage for d2b10d1 (2b10 D:-4-103)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (43 PDB entries)
   Uniprot P00044

8. Domain d2b10d1: 2b10 D:-4-103 [144944]
   Other proteins in same PDB: d2b10a1, d2b10c1
   automatically matched to 2B10 B:-4-103
   complexed with hem, znh

Details for d2b10d1

PDB Entry: 2b10, 2.8 Å

PDB Description: crystal structure of the protein-protein complex between f82s cytochrome c and cytochrome c peroxidase

PDB Compounds: (D:) Cytochrome c iso-1

SCOP Domain Sequences for d2b10d1:

Sequence; same for both SEQRES and ATOM records:

>d2b10d1 a.3.1.1 (D:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkace

Timeline for d2b10d1:

• d2b10d1 is new in SCOP 1.75
  
• d2b10d1 is called d2b10d_ in SCOPe 2.01
  
• d2b10d1 appears in the current release, SCOPe 2.08, called d2b10d_