Lineage for d2b10d_ (2b10 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691155Domain d2b10d_: 2b10 D: [144944]
    Other proteins in same PDB: d2b10a_, d2b10c_
    automated match to d2b10b1
    complexed with hem, znh

Details for d2b10d_

PDB Entry: 2b10 (more details), 2.8 Å

PDB Description: crystal structure of the protein-protein complex between f82s cytochrome c and cytochrome c peroxidase
PDB Compounds: (D:) Cytochrome c iso-1

SCOPe Domain Sequences for d2b10d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b10d_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmasgglkkekdrndlitylkkace

SCOPe Domain Coordinates for d2b10d_:

Click to download the PDB-style file with coordinates for d2b10d_.
(The format of our PDB-style files is described here.)

Timeline for d2b10d_: