SCOPe 2.08: Domain d2axtl1: 2axt L:1-37

Lineage for d2axtl1 (2axt L:1-37)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
   Uniprot Q8DIN8 1-37

8. Domain d2axtl1: 2axt L:1-37 [144936]
   Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
   complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtl1

PDB Entry: 2axt, 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus

PDB Compounds: (L:) Photosystem II reaction center L protein

SCOPe Domain Sequences for d2axtl1:

Sequence; same for both SEQRES and ATOM records:

>d2axtl1 f.23.31.1 (L:1-37) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d2axtl1:

• d2axtl1 first appeared in SCOP 1.75
  
• d2axtl1 appears in SCOPe 2.07