Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2axti1 (2axt I:1-35)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
  5. Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. Protein Photosystem II reaction center protein I, PsbI [161043] (1 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161044] (1 PDB entry)
    Uniprot Q8DJZ6 1-35
  8. Domain d2axti1: 2axt I:1-35 [144933]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axti1

PDB Entry: 2axt (more details)
PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (I:) Photosystem II reaction center I protein

SCOP Domain Sequences for d2axti1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axti1 f.23.37.1 (I:1-35) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk

SCOP Domain Coordinates for d2axti1:

Click to download the PDB-style file with coordinates for d2axti1.
(The format of our PDB-style files is described here.)

Timeline for d2axti1:

d2axti1 appears in SCOP 1.75A


d2axti1
(click for larger image)


d2axti1 in context of chain



d2axti1 in context of PDB
Domains from other chains:
d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu