Domain d2axth1: 2axt H:2-65

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d2axth1 (2axt H:2-65)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
not a true fold
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family)
Family f.23.33.1: PsbH-like [161026] (2 protein domains)
Pfam PF00737
Protein Photosystem II reaction center protein H, PsbH [161027] (1 species)
Species Thermosynechococcus elongatus [TaxId:146786] [161028] (1 PDB entry)
Uniprot Q8DJ43 2-65

Domain d2axth1: 2axt H:2-65 [144932]
Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

PDB Entry: 2axt (more details)
PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (H:) Photosystem II reaction center H protein

SCOP Domain Sequences for d2axth1:
Sequence; same for both SEQRES and ATOM records: (download)

>d2axth1 f.23.33.1 (H:2-65) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkal

SCOP Domain Coordinates for d2axth1:

Click to download the PDB-style file with coordinates for d2axth1.
(The format of our PDB-style files is described here.)

Timeline for d2axth1:
d2axth1 appears in SCOP 1.75A

d2axth1
(click for larger image)

d2axth1 in context of chain

d2axth1 in context of PDB
Domains from other chains:
d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1