Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2axtb1 (2axt B:2-489)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
  5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 protein domains)
    Pfam PF00421
  6. Protein Photosystem II core light harvesting protein PsbB [161079] (1 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161080] (1 PDB entry)
    Uniprot Q8DIQ1 2-489
  8. Domain d2axtb1: 2axt B:2-489 [144927]
    Other proteins in same PDB: d2axta1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtb1

PDB Entry: 2axt (more details)
PDB Description: crystal structure of photosystem ii from thermosynechococcus
PDB Compounds: (B:) CP47 protein

SCOP Domain Sequences for d2axtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtb1 f.55.1.1 (B:2-489) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspe

SCOP Domain Coordinates for d2axtb1:

Click to download the PDB-style file with coordinates for d2axtb1.
(The format of our PDB-style files is described here.)

Timeline for d2axtb1:

d2axtb1 appears in SCOP 1.75A


d2axtb1
(click for larger image)


d2axtb1 in context of chain



d2axtb1 in context of PDB
Domains from other chains:
d2axta1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv1, d2axtz1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu