Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161054] (3 PDB entries) Uniprot P0A445 10-344 |
Domain d2axta1: 2axt A:10-344 [144926] Other proteins in same PDB: d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axta1 f.26.1.1 (A:10-344) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]} sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida kgnvintwadiinranlgmevmhernahnfpldla
Timeline for d2axta1: