SCOPe 2.08: Domain d2axta1: 2axt A:10-344

Lineage for d2axta1 (2axt A:10-344)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein Photosystem Q(B) protein 1, PsbA1 [161053] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161054] (3 PDB entries)
   Uniprot P0A445 10-344

8. Domain d2axta1: 2axt A:10-344 [144926]
   Other proteins in same PDB: d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
   complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axta1

PDB Entry: 2axt, 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus

PDB Compounds: (A:) Photosystem Q(B) protein

SCOPe Domain Sequences for d2axta1:

Sequence; same for both SEQRES and ATOM records:

>d2axta1 f.26.1.1 (A:10-344) Photosystem Q(B) protein 1, PsbA1 {Thermosynechococcus elongatus [TaxId: 146786]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

Timeline for d2axta1:

• d2axta1 first appeared in SCOP 1.75
  
• d2axta1 appears in SCOPe 2.07