![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159078] (29 PDB entries) Uniprot P02411 2-122 |
![]() | Domain d2awbk1: 2awb K:2-122 [144918] Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1 automatically matched to 2AW4 K:2-122 complexed with mg |
PDB Entry: 2awb (more details), 3.46 Å
SCOP Domain Sequences for d2awbk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awbk1 b.39.1.1 (K:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} iqeqtmlnvadnsgarrvmcikvlggshrryagvgdiikitikeaiprgkvkkgdvlkav vvrtkkgvrrpdgsvirfdgnacvllnnnseqpigtrifgpvtrelrsekfmkiislape v
Timeline for d2awbk1:
![]() Domains from other chains: (mouse over for more information) d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1 |