SCOPe 2.05: Domain d2awbc2: 2awb C:61-124

Lineage for d2awbc2 (2awb C:61-124)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2awbc2: 2awb C:61-124 [144907]
   Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1, d2awbz1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2awbc2

PDB Entry: 2awb, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2awbc2:

Sequence; same for both SEQRES and ATOM records:

>d2awbc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2awbc2:

• d2awbc2 first appeared in SCOP 1.75
  
• d2awbc2 appears in SCOPe 2.04
  
• d2awbc2 appears in SCOPe 2.06
  
• d2awbc2 appears in the current release, SCOPe 2.08