Lineage for d2aw7u1 (2aw7 U:3-53)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273286Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2273287Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 2273288Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 2273289Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 2273290Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 2273304Domain d2aw7u1: 2aw7 U:3-53 [144905]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw7u1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2aw7u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2aw7u1:

Click to download the PDB-style file with coordinates for d2aw7u1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7u1: