Class j: Peptides [58231] (120 folds) |
Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) |
Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
Protein Ribosomal protein S21, RpsU [161310] (1 species) |
Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
Domain d2aw7u1: 2aw7 U:3-53 [144905] Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1 automatically matched to 2AVY U:3-53 protein/RNA complex; complexed with mg |
PDB Entry: 2aw7 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw7u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw7u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2aw7u1: