Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
Domain d2aw7s1: 2aw7 S:2-80 [144903] Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7t1, d2aw7u1 automatically matched to 2AVY S:2-80 protein/RNA complex; complexed with mg |
PDB Entry: 2aw7 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw7s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw7s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2aw7s1: