SCOPe 2.05: Domain d2aw7r1: 2aw7 R:19-73

Lineage for d2aw7r1 (2aw7 R:19-73)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2aw7r1: 2aw7 R:19-73 [144902]
   Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7s1, d2aw7t1, d2aw7u1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2aw7r1

PDB Entry: 2aw7, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2aw7r1:

Sequence; same for both SEQRES and ATOM records:

>d2aw7r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2aw7r1:

• d2aw7r1 first appeared in SCOP 1.75
  
• d2aw7r1 appears in SCOPe 2.04
  
• d2aw7r1 appears in SCOPe 2.06
  
• d2aw7r1 appears in the current release, SCOPe 2.08