Lineage for d2aw7r1 (2aw7 R:19-73)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080920Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1080921Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1080922Protein Ribosomal protein S18 [46913] (2 species)
  7. 1080923Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1080935Domain d2aw7r1: 2aw7 R:19-73 [144902]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY R:19-73
    protein/RNA complex; complexed with mg

Details for d2aw7r1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2aw7r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2aw7r1:

Click to download the PDB-style file with coordinates for d2aw7r1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7r1: