Lineage for d2aw7n1 (2aw7 N:1-100)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. Protein Ribosomal protein S14 [57753] (2 species)
  7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. Domain d2aw7n1: 2aw7 N:1-100 [144898]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

    has additional insertions and/or extensions that are not grouped together

Details for d2aw7n1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2aw7n1:

Sequence, based on SEQRES records: (download)

>d2aw7n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2aw7n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOPe Domain Coordinates for d2aw7n1 are not available.

Timeline for d2aw7n1: