Lineage for d2aw7m1 (2aw7 M:1-113)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100749Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1100750Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1100751Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 1100752Protein Ribosomal protein S13 [46948] (2 species)
  7. 1100753Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 1100765Domain d2aw7m1: 2aw7 M:1-113 [144897]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    automatically matched to 2AVY M:1-114
    protein/RNA complex; complexed with mg

Details for d2aw7m1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2aw7m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7m1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk

SCOPe Domain Coordinates for d2aw7m1:

Click to download the PDB-style file with coordinates for d2aw7m1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7m1: