Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Escherichia coli [TaxId:562] [159644] (24 PDB entries) Uniprot P0A7R9 12-128 |
Domain d2aw7k1: 2aw7 K:12-128 [144895] Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2aw7 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw7k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw7k1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
Timeline for d2aw7k1: