Lineage for d2aw7i1 (2aw7 I:3-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930174Protein Ribosomal protein S9 [54218] (2 species)
  7. 2930175Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 2930189Domain d2aw7i1: 2aw7 I:3-129 [144893]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw7i1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2aw7i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7i1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
rpqfskr

SCOPe Domain Coordinates for d2aw7i1:

Click to download the PDB-style file with coordinates for d2aw7i1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7i1: