Lineage for d2aw7f1 (2aw7 F:1-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196631Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2196632Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2196633Protein Ribosomal protein S6 [54997] (4 species)
  7. 2196636Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 2196650Domain d2aw7f1: 2aw7 F:1-100 [144891]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7c2, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw7f1

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2aw7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7f1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2aw7f1:

Click to download the PDB-style file with coordinates for d2aw7f1.
(The format of our PDB-style files is described here.)

Timeline for d2aw7f1: