Lineage for d2aw7c2 (2aw7 C:106-206)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170861Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2170862Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2170863Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2170864Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2170865Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 2170879Domain d2aw7c2: 2aw7 C:106-206 [144887]
    Other proteins in same PDB: d2aw7b1, d2aw7c1, d2aw7d1, d2aw7e1, d2aw7e2, d2aw7f1, d2aw7g1, d2aw7h1, d2aw7i1, d2aw7j1, d2aw7k1, d2aw7l1, d2aw7m1, d2aw7n1, d2aw7o1, d2aw7p1, d2aw7q1, d2aw7r1, d2aw7s1, d2aw7t1, d2aw7u1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw7c2

PDB Entry: 2aw7 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2aw7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw7c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2aw7c2:

Click to download the PDB-style file with coordinates for d2aw7c2.
(The format of our PDB-style files is described here.)

Timeline for d2aw7c2: