Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) some topological similarity to ribosomal protein L22 |
Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
Species Escherichia coli [TaxId:562] [160270] (27 PDB entries) Uniprot P02416 1-127 |
Domain d2aw4n1: 2aw4 N:1-127 [144878] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 Representative structure protein/RNA complex; complexed with mg |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOPe Domain Sequences for d2aw4n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4n1 d.188.1.1 (N:1-127) Prokaryotic ribosomal protein L17 {Escherichia coli [TaxId: 562]} mrhrksgrqlnrnsshrqamfrnmagslvrheiikttlpkakelrrvveplitlaktdsv anrrlafartrdneivaklfnelgprfasraggytrilkcgfragdnapmayielvdrse kaeaaae
Timeline for d2aw4n1:
View in 3D Domains from other chains: (mouse over for more information) d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4i2, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1 |