Lineage for d2aw4i2 (2aw4 I:1-72)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190365Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2190366Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2190367Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2190371Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2190377Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2190393Domain d2aw4i2: 2aw4 I:1-72 [144875]
    Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4c1, d2aw4c2, d2aw4d1, d2aw4e1, d2aw4f1, d2aw4g1, d2aw4g2, d2aw4h1, d2aw4h2, d2aw4i1, d2aw4j1, d2aw4k1, d2aw4l1, d2aw4m1, d2aw4n1, d2aw4o1, d2aw4p1, d2aw4q1, d2aw4r1, d2aw4s1, d2aw4t1, d2aw4u1, d2aw4v1, d2aw4w1, d2aw4x1, d2aw4y1, d2aw4z1
    Representative structure
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2aw4i2

PDB Entry: 2aw4 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of one 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2aw4i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw4i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2aw4i2:

Click to download the PDB-style file with coordinates for d2aw4i2.
(The format of our PDB-style files is described here.)

Timeline for d2aw4i2: